PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g014360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 460aa    MW: 51826.4 Da    PI: 8.535
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g014360.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.91.4e-2196190298
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     ++  ++ ++l+++rl l++kf++ +g ++ +  ++ + +e+gr We+kl  +++sg +++++GW++F++ n+L++gDf+ Fkl +  ++++v+++
  Csa12g014360.1  96 ITGCVTRYSLSKDRLDLSRKFTAFFG-EHLKASEIDVINEQGRIWEMKLAKNNSSGVFYIRAGWQHFCSTNDLRQGDFCKFKLFQ-IGERPVLSL 188
                     55668899**************7774.4456669***************99999999*************************977.556678777 PP

                     E- CS
              B3  97 fr 98 
                     + 
  Csa12g014360.1 189 CP 190
                     75 PP

2B363.63.2e-20225318799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE......EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy....rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +++   +g+l+lp +f++e+g++k++  +++l d++gr+W+ +l++    r  s++++l+kGW+e+++ ng+k++D++ ++l++ +++++++k++
  Csa12g014360.1 225 TPSRDYTGQLSLPVSFTRENGINKAG--DVILLDQDGRKWSSYLQItglgRDVSEWFYLRKGWREMCEPNGVKVNDSFKLELMW-EGANPLFKFC 316
                     566677789**************888..7***************998998888899****************************.9999*****9 PP

                     -S CS
              B3  98 rk 99 
                     +k
  Csa12g014360.1 317 SK 318
                     87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508637.697792IPR003340B3 DNA binding domain
SMARTSM010190.0211081IPR003340B3 DNA binding domain
SuperFamilySSF1019363.34E-62773IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.0E-53373IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.3E-1790191IPR015300DNA-binding pseudobarrel domain
PfamPF023623.9E-1895190IPR003340B3 DNA binding domain
PROSITE profilePS5086313.74795191IPR003340B3 DNA binding domain
SMARTSM010193.6E-2395192IPR003340B3 DNA binding domain
SuperFamilySSF1019361.75E-1895192IPR015300DNA-binding pseudobarrel domain
CDDcd100171.43E-18105190No hitNo description
Gene3DG3DSA:2.40.330.107.2E-18214318IPR015300DNA-binding pseudobarrel domain
CDDcd100174.74E-15218317No hitNo description
SMARTSM010191.1E-21219319IPR003340B3 DNA binding domain
PROSITE profilePS5086312.026219318IPR003340B3 DNA binding domain
PfamPF023627.6E-21222318IPR003340B3 DNA binding domain
SuperFamilySSF1019366.28E-18222323IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MADTPHFSSF EHKFLTGDKP LLTLDAEFLM NHTKVLLISD ASDRVWKVKL DGGRLADGWE  60
EFAGEHGFKD GDVEDCCDSG NKKPEADSSS GQSCFITGCV TRYSLSKDRL DLSRKFTAFF  120
GEHLKASEID VINEQGRIWE MKLAKNNSSG VFYIRAGWQH FCSTNDLRQG DFCKFKLFQI  180
GERPVLSLCP QESGNGHKEK RALDEVSKRK EKKKAPSPTV IIKYTPSRDY TGQLSLPVSF  240
TRENGINKAG DVILLDQDGR KWSSYLQITG LGRDVSEWFY LRKGWREMCE PNGVKVNDSF  300
KLELMWEGAN PLFKFCSKIE NHDYKGKGNH TTRRKRACET APQPRNVRKT PRVGVEGQVN  360
KRRSRGPEHQ ADEERGRTQV SNRTNTISRN FLSAQPQSCS VSDQVASVKQ GIVDTLNTVR  420
QCQTELETSE QNLQASLLAI DALGERIWGI SKILSNDLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010447522.10.0PREDICTED: B3 domain-containing protein REM1-like
SwissprotQ84J390.0REM1_ARATH; B3 domain-containing protein REM1
TrEMBLR0F9690.0R0F969_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.7__1010__AT4G31610.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99501736
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31610.10.0B3 family protein